PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.J00318.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family WRKY
Protein Properties Length: 319aa    MW: 35921.7 Da    PI: 4.8943
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.J00318.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.69.3e-32134190258
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                       dDgy+WrKYGqK++k+s++prsYYrCt ++C++kk+vers +d ++++itYeg H h
  Migut.J00318.1.p 134 DDGYKWRKYGQKSIKNSPNPRSYYRCTNPRCSAKKQVERSVDDSDTLIITYEGLHLH 190
                       8******************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.9E-30123190IPR003657WRKY domain
PROSITE profilePS5081126.9128190IPR003657WRKY domain
SuperFamilySSF1182901.18E-26129190IPR003657WRKY domain
SMARTSM007741.3E-35133192IPR003657WRKY domain
PfamPF031063.2E-25134190IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MDELIKLTGG SSTAYEDELV KELFDDVSPF FMQPHHHSLI MESNFIPSTY SQIPSPVYSG  60
PTVEDIETAL SYTNYGIHST FHHEAVSEAD RMLMVNNNNN QNKVNDYYNN NNNNDQSSKY  120
TLRIKSCGNN VMADDGYKWR KYGQKSIKNS PNPRSYYRCT NPRCSAKKQV ERSVDDSDTL  180
IITYEGLHLH FTYPFFFLNN QQQNYPPVKK LKGPPVFESQ IENGFGSPFT PNPDPVQTTG  240
PPAEEVLTGQ PAEQGLLEDM VPLMIRKPAL MMDYSYKYNP ASSNNSSSNS ANNSLDESLP  300
SSPASFDSFP WSPTYLGY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A5e-211321901371WRKY transcription factor 1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012831749.10.0PREDICTED: probable WRKY transcription factor 49
STRINGVIT_08s0007g00570.t011e-68(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA120752124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43290.16e-43WRKY DNA-binding protein 49